PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054953.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 286aa    MW: 31198.1 Da    PI: 8.5792
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054953.60genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.71.2e-16210244135
          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                   C++C +  Tp+WR gp g+ktLCnaCG++y++ +l
  EcC054953.60 210 CTHCLSQRTPQWRAGPMGPKTLCNACGVRYKSGRL 244
                   *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.189204240IPR000679Zinc finger, GATA-type
SMARTSM004015.7E-16204258IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-15205268No hitNo description
Gene3DG3DSA:3.30.50.101.2E-13207242IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.90E-11209256No hitNo description
PROSITE patternPS003440210235IPR000679Zinc finger, GATA-type
PfamPF003201.5E-14210244IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MEFCRNVSVP GDSQPKLGGF ASNSLDELCS IQKPEADVSM EWLSVFVEDC LSSSGNTLQV  60
QTLPTPSSAS VPSKTPSKPS STNLPSLHKI VVTGKARSKR KRIAAAKTKN NAFLMMPAWP  120
NHSADPLLLH QSHWLADSEL IQPKKQEQEQ EQPKKQEQEL PKTTTTNMPS SPTQCDAEEE  180
EAVESKEDHS EESGGGGGGG AGQQGTGRRC THCLSQRTPQ WRAGPMGPKT LCNACGVRYK  240
SGRLLPEYRP AKSPTFVSYL HSNSHKKVME MRSSNISILS PSGERR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054482.10.0PREDICTED: GATA transcription factor 2-like
TrEMBLA0A059DH000.0A0A059DH00_EUCGR; Uncharacterized protein
STRINGGLYMA16G04670.22e-77(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.16e-35GATA transcription factor 4